PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013609883.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 334aa    MW: 38163.5 Da    PI: 6.4419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013609883.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.9e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
   XP_013609883.1 15 KGPWTPEEDQKLIDYINKHGYGNWRTLPKNAGLERCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.33.2e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e++++++  +G++ W++Ia++++ gRt++++k++w+++
   XP_013609883.1  68 RGRFSFEEEEIIIQLHSIMGNK-WSAIAARLP-GRTDNEIKNYWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7151062IPR017930Myb domain
SuperFamilySSF466891.83E-3212109IPR009057Homeodomain-like
SMARTSM007171.4E-141464IPR001005SANT/Myb domain
PfamPF002496.2E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-251669IPR009057Homeodomain-like
CDDcd001672.59E-131762No hitNo description
PROSITE profilePS5129425.59863117IPR017930Myb domain
SMARTSM007174.2E-1767115IPR001005SANT/Myb domain
PfamPF002491.8E-1568112IPR001005SANT/Myb domain
CDDcd001675.88E-1370113No hitNo description
Gene3DG3DSA:1.10.10.606.9E-2770117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRSPCLDKK IGLKKGPWTP EEDQKLIDYI NKHGYGNWRT LPKNAGLERC GKSCRLRWTN  60
YLRPDIKRGR FSFEEEEIII QLHSIMGNKW SAIAARLPGR TDNEIKNYWN THIRKRLLKL  120
GIDPVTHSPR LDLLDISSIL SSSVYNSSHH HQQNMLRLMM GDGHHHHQPL VNPEILKLAT  180
SLFSNSQQQC KNQNNPTNTH EVNQPEVNQY QTAYNIIGNQ ELQSCFPSMD QFAEFQDPMP  240
TTTFPDSVHS LPLNQDYDYS TSNFALEPFY SDFASVLATP SSSPTPLDSS STTYINSSTC  300
STEDEKESYC NNNFMNSSEI GPDYSFDVNG FLQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31131175108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00429DAPTransfer from AT4G05100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869321e-168AF386932.1 Arabidopsis thaliana Unknown protein mRNA, complete cds.
GenBankBT0011821e-168BT001182.1 Arabidopsis thaliana Unknown protein (At4g05100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609883.10.0PREDICTED: protein ODORANT1
TrEMBLA0A0D3E8280.0A0A0D3E828_BRAOL; Uncharacterized protein
STRINGBra029553.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.11e-150myb domain protein 74